Skip to main content

Table 1 Alignment of amino acid sequence of envelope region of various single and double antigen fusion proteins.

From: Bifunctional recombinant fusion proteins for rapid detection of antibodies to both HIV-1 and HIV-2 in whole blood

Protein AMINO ACID SEQUENCES OF HIV-1 and HIV-2 ANTIGENS FUSED AT THE C-TERMINUS OF Fd
  Fd------- -------ENV1S/C-------------LINKER L-----------------ENV2S/C----------------cmyc
Fd NASG
Fdenv1S NASGVERYLKDQQLLGIWGSSGKLISTTAVPWNAS----------------------------------------------EQKLISEEDLN
Fdenv1C NASGVERYLKDQQLLGIWGCSGKLICTTAVPWNAS----------------------------------------------EQKLISEEDLN
Fdenv2S NASG------------------------------------------ AIEKYLQDQARLNSWGSAFRQVSHTTVPWVNGASEQKLISEEDLN
Fdenv2C NASG------------------------------------------ AIEKYLQDQARLNSWGCAFRQVCHTTVPWVNGASEQKLISEEDLN
Fdenv12SS NASGVERYLKDQQLLGIWGSSGKLISTTAVPWSNASGGGSGGGASGAIEKYLQDQARLNSWGSAFRQVSHTTVPWVNGASEQKLISEEDLN
Fdenv12CC NASGVERYLKDQQLLGIWGCSGKLICTTAVPWSNASGGGSGGGASGAIEKYLQDQARLNSWGCAFRQVCHTTVPWVNGASEQKLISEEDLN
Fdenv12CS NASGVERYLKDQQLLGIWGCSGKLICTTAVPWSNASGGGSGGGASGAIEKYLQDQARLNSWGSAFRQVSHTTVPWVNGASEQKLISEEDLN
Fdenv12SC NASGVERYLKDQQLLGIWGSSGKLISTTAVPWSNASGGGSGGGASGAIEKYLQDQARLNSWGCAFRQVCHTTVPWVNGASEQKLISEEDLN
  1. Amino acids are shown in single letter code with Serine (S) and Cysteine (C) in bold letters. The linker is shown in bold letters. Various proteins are shown diagrammatically in Fig. 2.