Skip to main content

Table 2 Amino acid sequences of HiR6.8, HiR7.6, and HiR7.8

From: Identification of an antibody fragment specific for androgen-dependent prostate cancer cells

Sequence name Sequence Predicted molecular weight
HiR6.8 DVPDYALQASGGGGSGGGGSGGGGSASQVQLVQSGAEVKKPGASVKVSCKASGYTFTDYYMHWVRQAPGQGLEWMGWINPNSGGTNYAQKFQGRVTMTRDTSISTAYMELSSLRSDDTAIYYCARDADSGSMSAIYWYFNLWGRGTLVTVSSGILGSGGGGSGGGGSGGGGSDIQLTQSPSSLSASVGDRVTITCRASQSISRFLNWYQQKPGKAPKLLIYGGSSLQSGVPSRFSGGGSGTDFTLTISSLQPEDFATYYCQQSYSKFWTFGQGTKVEIKSGILEQKLISEEDL 30.6 kDa
HiR7.6 DVPDYALQASGGGGSGGGGSGGGGSASQVQLQESGPGLVKPSGTLSLTCAVSGGSISSSNWWSWVRQPPGKELEWIGEIHHSGSTNYNPSLKSRVTISVDKSKNQFSLKMRSVTAADTAVYYCARVEEWPYDALDMWGQGTMVTVSSEF 15.6 kDa
HiR7.8 DVPDYALQASGGGGSGGGGSGGGGSASQVQLQESGPGLVKPSQTLSLTCTVSGDSIYSSGHYWSWVRQHPGKGLEWIGYIYASGRTYYNPSLESRVTMSVDTSKNQSSLKLTSVTAADTAVYYCARDDSRTWYKAFDTWGQGTMVTVSSEF 16.0 kDa
  1. Italicized amino acids represent the heavy chain. Bold amino acids represent the light chain. HiR7.6 and HiR7.8 do not contain a light chain. Non-italicized or bolded amino acids represent scFv structural elements.